PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn336751
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family Nin-like
Protein Properties Length: 992aa    MW: 108882 Da    PI: 4.8983
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn336751genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK91.85e-29589640152
      RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                 aek++sl++l++yFs+++kdAAk++gvc+T+LKriCRq+GI+RWP+Rki+++
  Achn336751 589 AEKHVSLSVLQQYFSGSLKDAAKSIGVCPTTLKRICRQHGISRWPSRKINKV 640
                 5899**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151916.779579660IPR003035RWP-RK domain
PfamPF020424.1E-26593640IPR003035RWP-RK domain
SuperFamilySSF542771.8E-23880975No hitNo description
PROSITE profilePS5174522.136891973IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2401.9E-25891972No hitNo description
SMARTSM006662.7E-25891973IPR000270PB1 domain
PfamPF005649.7E-20892972IPR000270PB1 domain
CDDcd064078.49E-33892972No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 992 aa     Download sequence    Send to blast
MEYPFSSKER GGYWASPRGQ MEGGISSEDP FNNVVEHMNF DTYAGWCSSP QTADPLFSAY  60
AFSPLQSMPS TSYAPFDALN FNEQNIASLP GPDGDVSGSS YSGGDKMVFQ HMNTQFGFPM  120
DSSGWDDPGT RKGSGSFQQN VTGNGLVPRP LAQTLSEKML RALSLFKESS GGGILAQVWV  180
PIKNGDRYIL STCEQPYLLD QMLTGYREVS RAYTFSAEEK PGSFPGLPGR VFISKLPEWT  240
SNVVYYNAAE YLRIQHAVDH EVRGSIALPI FEEDPLEMSC CAVLELVTMK EKPNFDSEME  300
IVCRALQAVS LRSTAPPKLY SQYLSKNQRA ALAEITDVLR AVCHAHRLPL ALTWIPCCYN  360
EGVGNDILRL RVKGGNASLN EKCILCIEDT ACYVNDREMQ EFVYACAEHY LEEGQGIAGK  420
ALQSNHPFFF PDVKSYDMSD YPLVQHARKF GLTAAVAIRL RSTFTGDDDY ILEFFLPVNM  480
KGSTEQQLLL NNLSGTMQRI CKSLRTVLDA ELVGTKGSNV EFQKGSLPNF PPVAISRRNS  540
QQTLDSSLNS IDQMALDASD PRTVRSEPDG PLEQMSESRR LTEKKRSTAE KHVSLSVLQQ  600
YFSGSLKDAA KSIGVCPTTL KRICRQHGIS RWPSRKINKV NRSLRKIQTV LDSVQGVEGG  660
LKFDPTTGGL VSAGSIIQEF DTGGSILFPN KNPSHKKPES VSQDAPSVCP PSCTDTENST  720
VKLEEENYMD GNQAGLPRSL FTLNTYEGEN DSKISQTDCC DDSKSAALDA GDLEQVSLDT  780
GAWTCSEDAS LRSFFGKQGC KSLNTSGLKF ENSDSHFFSR DSDEMDTGMD GDMGMRADDG  840
VIEHNQPTSS GMTDSSNGSG SAMRDSSSSS PSFGGRRHSN THMSSGDSGS KITVKATYKE  900
DTVRFKFEPS LGCNQLYEEV AKRFKLQPGT FQLKYLDDEQ EWVMLVSDAD LQECLEVLDF  960
VGTRSVKFLV RDVPCAMGSS GSSNCFLAAS T*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009795771.10.0PREDICTED: protein NLP9-like
RefseqXP_009795773.10.0PREDICTED: protein NLP9-like
RefseqXP_009795774.10.0PREDICTED: protein NLP9-like
RefseqXP_009795775.10.0PREDICTED: protein NLP9-like
RefseqXP_009795776.10.0PREDICTED: protein NLP9-like
RefseqXP_009795777.10.0PREDICTED: protein NLP9-like
RefseqXP_009795778.10.0PREDICTED: protein NLP9-like
SwissprotO228640.0NLP8_ARATH; Protein NLP8
TrEMBLA0A061ER470.0A0A061ER47_THECC; Plant regulator RWP-RK family protein, putative isoform 1
STRINGPGSC0003DMT4000341880.0(Solanum tuberosum)
STRINGSolyc11g045350.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA39812445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G43500.20.0Nin-like family protein